PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG044800.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 265aa    MW: 30098.2 Da    PI: 9.6414
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG044800.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.11.7e-313685150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  Pavir.5KG044800.6.p 36 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 85
                         79***********************************************8 PP

2K-box100.81.8e-331042004100
                K-box   4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                          s++   ++e +a+++qqe+akL++ i++Lq+++R l+G+ ++++sl++L+q+e +Lek+++kiR++Knell++++e++qk+e +lq++n+
  Pavir.5KG044800.6.p 104 SNS-GtVAEVNAQHYQQESAKLRQTINSLQNSNRTLVGDAIQTMSLRDLKQMEVRLEKGISKIRARKNELLYAEVEYMQKREMDLQSDNM 192
                          333.25999********************************************************************************* PP

                K-box  93 aLrkklee 100
                          +Lr+k++e
  Pavir.5KG044800.6.p 193 YLRSKVAE 200
                          *****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.2212888IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-412887IPR002100Transcription factor, MADS-box
CDDcd002651.47E-4629102No hitNo description
SuperFamilySSF554554.45E-3329100IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003084IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-333050IPR002100Transcription factor, MADS-box
PfamPF003191.0E-263784IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-335065IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-336586IPR002100Transcription factor, MADS-box
PfamPF014861.0E-24113198IPR002487Transcription factor, K-box
PROSITE profilePS5129714.063114204IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MLNMMADLSC GSSKVKEQPA PTGSSDKPGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY  60
ELSVLCDAEV ALIVFSSRGR LYEYANNSVK ATIERYKKAN SDTSNSGTVA EVNAQHYQQE  120
SAKLRQTINS LQNSNRTLVG DAIQTMSLRD LKQMEVRLEK GISKIRARKN ELLYAEVEYM  180
QKREMDLQSD NMYLRSKVAE NNERGQPPMN MMGAPSTSEY DHMAPYDSRN FLQVNIMQQP  240
QHYSHQLQPT TLQLGYKFNI CSSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A5e-2129115190Myocyte-specific enhancer factor 2A
3kov_B5e-2129115190Myocyte-specific enhancer factor 2A
3kov_I5e-2129115190Myocyte-specific enhancer factor 2A
3kov_J5e-2129115190Myocyte-specific enhancer factor 2A
3p57_A5e-2129115190Myocyte-specific enhancer factor 2A
3p57_B5e-2129115190Myocyte-specific enhancer factor 2A
3p57_C5e-2129115190Myocyte-specific enhancer factor 2A
3p57_D5e-2129115190Myocyte-specific enhancer factor 2A
3p57_I5e-2129115190Myocyte-specific enhancer factor 2A
3p57_J5e-2129115190Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.43540.0leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9608100.0EU960810.1 Zea mays clone 228787 MADS-box transcription factor 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968556.11e-179PREDICTED: MADS-box transcription factor 3 isoform X1
SwissprotQ407041e-150MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLC5XL841e-170C5XL84_SORBI; Putative uncharacterized protein Sb03g002525
STRINGSb03g002525.11e-170(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-105MIKC_MADS family protein